PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.2059s0010.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family NAC
Protein Properties Length: 351aa    MW: 38819.6 Da    PI: 8.2624
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.2059s0010.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM177.92.8e-55141421129
                     NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 
                             lppGfrFhPtde+l+++yL kkv +++++  ++i+evd++k+ePw+Lp k+k +ekewyfF  rd+ky+tg r+nrat++gyWkatg
  SapurV1A.2059s0010.1.p  14 LPPGFRFHPTDEDLITYYLLKKVLDSNFTG-RAIAEVDLNKCEPWELPGKAKMGEKEWYFFNLRDRKYPTGLRTNRATEAGYWKATG 99 
                             79*************************999.89***************99999********************************** PP

                     NAM  88 kdkevlsk.kgelvglkktLvfykgrapkgektdWvmheyrle 129
                             kd+e++s+ +g+lvg+kktLvfy+grapkgek++Wvmheyrle
  SapurV1A.2059s0010.1.p 100 KDREIYSSkTGALVGMKKTLVFYRGRAPKGEKSNWVMHEYRLE 142
                             ******9867888****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.53E-6310166IPR003441NAC domain
PROSITE profilePS5100559.92714166IPR003441NAC domain
PfamPF023654.1E-2815141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010072Biological Processprimary shoot apical meristem specification
GO:0010160Biological Processformation of organ boundary
GO:0010223Biological Processsecondary shoot formation
GO:0048366Biological Processleaf development
GO:0048504Biological Processregulation of timing of organ formation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 351 aa     Download sequence    Send to blast
MESYHHFDCG DANLPPGFRF HPTDEDLITY YLLKKVLDSN FTGRAIAEVD LNKCEPWELP  60
GKAKMGEKEW YFFNLRDRKY PTGLRTNRAT EAGYWKATGK DREIYSSKTG ALVGMKKTLV  120
FYRGRAPKGE KSNWVMHEYR LEGKFAYHYL SRCSKDEWVI SRVFQKSCSG AAISGSGSAP  180
KKNRFNTTIN LYPEAGSPSS VSLPPLLDAT TAASNSTLND RDSCSYDSHT QHEHVSCFST  240
IAAAASAAAK YNINNFDLAT LPPPQMADSF SRFPRNTGPT SFPSLRSLQE NLQLPFFFPS  300
PPSAVAGPPF HGGGTAMSWM MNPEEGRVDG SGAGGRVTMG PTELDCMWTY *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-521317016169NO APICAL MERISTEM PROTEIN
1ut4_B4e-521317016169NO APICAL MERISTEM PROTEIN
1ut7_A4e-521317016169NO APICAL MERISTEM PROTEIN
1ut7_B4e-521317016169NO APICAL MERISTEM PROTEIN
4dul_A4e-521317016169NAC domain-containing protein 19
4dul_B4e-521317016169NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00562DAPTransfer from AT5G53950Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011029527.10.0PREDICTED: protein CUP-SHAPED COTYLEDON 2
SwissprotO040171e-117NAC98_ARATH; Protein CUP-SHAPED COTYLEDON 2
TrEMBLB9HZR20.0B9HZR2_POPTR; Uncharacterized protein
STRINGPOPTR_0011s11600.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF36893463
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53950.11e-108NAC family protein